PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g067000.2
Common NameMTR_1g067000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 299aa    MW: 32825.7 Da    PI: 5.9108
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g067000.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-134791147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W+ eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
  Medtr1g067000.2 47 RESWSDEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 91
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.64E-174197IPR009057Homeodomain-like
PROSITE profilePS5129415.4554296IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-64597IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-184594IPR006447Myb domain, plants
SMARTSM007175.3E-114694IPR001005SANT/Myb domain
PfamPF002495.3E-114791IPR001005SANT/Myb domain
CDDcd001671.30E-84992No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MFSVAEENQT MNSNSNSMAA PTTTTTTSGG DASGKKVRKP YTITKSRESW SDEEHDKFLE  60
ALQLFDRDWK KIEDFVGSKT VIQIRSHAQK YFLKVQKNGT LAHVPPPRPK RKAIHPYPQK  120
ATKNVLVPLP ASIAFGSSVN TLLPAGYVTW DETSMLMNTC QDELNSLHGN EADIGSKGIS  180
NSGLSGVEDT NTRLPTSQIP TQGTQNPVIH GLPDFAEVYG FIGSVFDPDT NGHVQKLKEM  240
DPINFETVLL LMRNLTVNLS SPNFDPIKKA MSTYDENNDA VGVTDDKKQT NDESCQTT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.94000.0flower| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1462370.0BT146237.1 Medicago truncatula clone JCVI-FLMt-7K4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013468258.10.0myb transcription factor
SwissprotQ8RWU31e-126RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A072VW350.0A0A072VW35_MEDTR; Myb transcription factor
STRINGGLYMA10G05560.11e-158(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-124MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]